PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do019134.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 240aa    MW: 26260.1 Da    PI: 4.2974
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do019134.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.64.3e-11156209861
                 HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                 +r ++NR +A +sR+RKk +++ Le+k+k Leae ++L   l+ +  e  +l++
  Do019134.1 156 IRQMRNRDSAMKSRERKKTYVKDLETKSKFLEAECRRLSYALQCYAAENMALRQ 209
                 699***********************************9999888877777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.002145213IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.75E-11156211No hitNo description
PfamPF001702.6E-9157210IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.864157214IPR004827Basic-leucine zipper domain
PROSITE patternPS000360157171IPR004827Basic-leucine zipper domain
CDDcd147041.68E-12157205No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-12157212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MDIDLLADID LDALLASFSG EPAGVSDLID PSPPPPAPTT AHDAEAGSPE SVTSRASPPR  60
EEALTEIERF LMQEGEAELG GEVEGISVDE FFDALYDGGE GEREREGKES EAGGSTDGGS  120
GRDEVVEVVT PEAETVEVDG DDPVSKKKRR WSCEFIRQMR NRDSAMKSRE RKKTYVKDLE  180
TKSKFLEAEC RRLSYALQCY AAENMALRQS LLKDRPVVAP TAMQESAVLT GKTHLVCHHE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1145149KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9576131e-105EU957613.1 Zea mays clone 1599137 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965858.11e-120PREDICTED: bZIP transcription factor 60-like
TrEMBLK3XYH01e-120K3XYH0_SETIT; Uncharacterized protein
STRINGSi006978m1e-119(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-12basic region/leucine zipper motif 60